PDB entry 1y69

View 1y69 on RCSB PDB site
Description: RRF domain I in complex with the 50S ribosomal subunit from Deinococcus radiodurans
Class: ribosome
Keywords: ribosome, 50s, rrf, recycling factor
Deposited on 2004-12-04, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 3.33 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain '0':
  Compound: 23S ribosomal RNA
  Species: Deinococcus radiodurans R1 [TaxId:243230]
  
• Chain '8':
  Compound: Ribosome-recycling factor
  Species: Escherichia coli [TaxId:83333]
  Gene: frr, rrf, b0172, JW0167
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A805 (0-29)
    • linker (30-32)
  • Uniprot P0A805 (33-112)
• Chain '9':
  Compound: 5S ribosomal RNA
  Species: Deinococcus radiodurans R1 [TaxId:243230]
  
• Chain 'K':
  Compound: 50S ribosomal protein L16
  Species: Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) [TaxId:243230]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9RXJ5
  Domains in SCOPe 2.07: d1y69k1
• Chain 'U':
  Compound: 50S ribosomal protein L27
  Species: Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) [TaxId:243230]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9RY65
  Domains in SCOPe 2.07: d1y69u1

PDB Chain Sequences:

• Chain '0':
  No sequence available.
  
  
• Chain '8':
  No sequence available.
  
  
• Chain '9':
  No sequence available.
  
  
• Chain 'K':
  Sequence, based on SEQRES records: (download)
  

  >1y69K (K:)
  mllpkrtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrr
  ggkiyirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrl
  aghklpiqtkmvkrevydeaq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y69K (K:)
  krtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggki
  yirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghk
  lpiqtkmvkrevydea
  

  
  
• Chain 'U':
  Sequence, based on SEQRES records: (download)
  

  >1y69U (U:)
  mahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlf
  alsdgkvvfinkgkgarfisieaaqtevaad
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y69U (U:)
  ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
  lsdgkvvfinkgkgarfisieaaq