PDB entry 1y69

View 1y69 on RCSB PDB site
Description: RRF domain I in complex with the 50S ribosomal subunit from Deinococcus radiodurans
Class: ribosome
Keywords: ribosome, 50s, rrf, recycling factor
Deposited on 2004-12-04, released 2005-03-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.33 Å
R-factor: 0.275
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
  • Chain '8':
    Compound: ribosome recycling factor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16174 (33-112)
      • see remark 999 (30-32)
  • Chain '9':
    Compound: 5S ribosomal RNA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1y69k1
  • Chain 'U':
    Compound: 50S ribosomal protein L27
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1y69u1

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1y69K (K:)
    mllpkrtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrr
    ggkiyirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrl
    aghklpiqtkmvkrevydeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y69K (K:)
    krtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggki
    yirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghk
    lpiqtkmvkrevydea
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1y69U (U:)
    mahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlf
    alsdgkvvfinkgkgarfisieaaqtevaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y69U (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaq