PDB entry 1y67

View 1y67 on RCSB PDB site
Description: Crystal Structure of Manganese Superoxide Dismutase from Deinococcus radiodurans
Class: oxidoreductase
Keywords: superoxide dismutase, manganese enzyme, metalloprotein, oxidoreductase
Deposited on 2004-12-03, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RUV2 (2-211)
      • expression tag (1)
      • expression tag (212-213)
    Domains in SCOPe 2.07: d1y67a1, d1y67a2, d1y67a3, d1y67a4
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RUV2 (2-211)
      • expression tag (1)
    Domains in SCOPe 2.07: d1y67b1, d1y67b2, d1y67b3
  • Chain 'C':
    Compound: manganese superoxide dismutase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RUV2 (2-211)
      • expression tag (212-213)
    Domains in SCOPe 2.07: d1y67c1, d1y67c2, d1y67c3
  • Chain 'D':
    Compound: manganese superoxide dismutase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RUV2 (2-211)
      • expression tag (212-215)
    Domains in SCOPe 2.07: d1y67d1, d1y67d2, d1y67d3
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y67A (A:)
    maaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafk
    qkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehay
    ylnyqnrrpdylaafwnvvnwdevskryaaaklvprgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y67A (A:)
    aaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqganqpsgelldainsafgsfdafkqkfe
    daaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylny
    qnrrpdylaafwnvvnwdevskryaaaklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y67B (B:)
    maaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafk
    qkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehay
    ylnyqnrrpdylaafwnvvnwdevskryaaaklvprgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y67B (B:)
    aaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqnqpsgelldainsafgsfdafkqkfedaak
    trfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqnrr
    pdylaafwnvvnwdevskryaaak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y67C (C:)
    maaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafk
    qkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehay
    ylnyqnrrpdylaafwnvvnwdevskryaaaklvprgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y67C (C:)
    aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
    rvpadkkgalrnnagghanhsmfwqimgnqpsgelldainsafgsfdafkqkfedaaktr
    fgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqnrrpd
    ylaafwnvvnwdevskryaaaklv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y67D (D:)
    maaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafk
    qkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehay
    ylnyqnrrpdylaafwnvvnwdevskryaaaklvprgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y67D (D:)
    aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
    rvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafkqk
    fedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayyl
    nyqnrrpdylaafwnvvnwdevskryaaaklvpr