PDB entry 1y66

View 1y66 on RCSB PDB site
Description: Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Deposited on 2004-12-03, released 2005-03-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.19
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: engrailed homeodomain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y66 (Start-51)
  • Chain 'B':
    Compound: engrailed homeodomain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y66
  • Chain 'C':
    Compound: engrailed homeodomain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y66
  • Chain 'D':
    Compound: engrailed homeodomain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y66
  • Heterogens: CD, DIO, ACY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y66A (A:)
    mkqwseeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeqrk
    

    Sequence, based on observed residues (ATOM records):
    >1y66A (A:)
    qwseeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeqrk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y66B (B:)
    mkqwseeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeqrk
    

    Sequence, based on observed residues (ATOM records):
    >1y66B (B:)
    seeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1y66C (C:)
    mkqwseeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeqrk
    

    Sequence, based on observed residues (ATOM records):
    >1y66C (C:)
    qwseeverklkefvrrhqeitqetlheyaqklglnqqaieqffr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1y66D (D:)
    mkqwseeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeqrk
    

    Sequence, based on observed residues (ATOM records):
    >1y66D (D:)
    seeverklkefvrrhqeitqetlheyaqklglnqqaieqffrefeq