PDB entry 1y65

View 1y65 on RCSB PDB site
Description: Crystal structure of beta-hexosaminidase from Vibrio cholerae in complex with N-acetyl-D-glucosamine to a resolution of 1.85
Class: hydrolase
Keywords: beta-alpha barrel, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2004-12-03, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Vibrio cholerae [TaxId:666]
    Gene: nagZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU37 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1y65a1, d1y65a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y65A (A:)
    mslgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpil
    igvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvl
    dmgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpy
    deretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgi
    vfsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeall
    kkqqfsyselkrlerwqqasanmqrlieqfseeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y65A (A:)
    slgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpili
    gvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvld
    mgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyd
    eretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgiv
    fsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallk
    kqqfsyselkrlerwqqasanmqrlieqfs