PDB entry 1y63

View 1y63 on RCSB PDB site
Description: Initial crystal structural analysis of a probable kinase from Leishmania major Friedlin
Class: Structural Genomics, Unknown Function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, SGPP, Structural Genomics of Pathogenic Protozoa Consortium, Unknown Function
Deposited on 2004-12-03, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmaj004144AAA protein
    Species: Leishmania major [TaxId:347515]
    Gene: LmjF30.1890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y63a_
  • Heterogens: MN, BR, NA, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y63A (A:)
    gpgsmeqpkginilitgtpgtgktsmaemiaaeldgfqhlevgklvkenhfyteydteld
    thiieekdedrlldfmepimvsrgnhvvdyhsselfperwfhmvvvlhtstevlferltk
    rqyseakraenmeaeiqciceeeardayeddivlvrendtleqmaatveeirervevlkv
    ergl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y63A (A:)
    eqpkginilitgtpgtgktsmaemiaaeldgfqhlevgklvkenhfytethiieekdedr
    lldfmepimvsrgnhvvdyhsselfperwfhmvvvlhtstevlferltkrqyseakraen
    meaeiqciceeeardayeddivlvrendtleqmaatveeirervevlk