PDB entry 1y62

View 1y62 on RCSB PDB site
Description: A 2.4 crystal structure of conkunitzin-S1, a novel Kunitz-fold cone snail neurotoxin.
Deposited on 2004-12-03, released 2005-07-12
The last revision was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conkunitzin-s1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y62
  • Chain 'B':
    Compound: conkunitzin-s1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y62
  • Chain 'C':
    Compound: conkunitzin-s1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y62
  • Chain 'D':
    Compound: conkunitzin-s1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y62
  • Chain 'E':
    Compound: conkunitzin-s1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y62
  • Chain 'F':
    Compound: conkunitzin-s1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y62
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y62A (A:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
    

    Sequence, based on observed residues (ATOM records):
    >1y62A (A:)
    rpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtcl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y62B (B:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
    

    Sequence, based on observed residues (ATOM records):
    >1y62B (B:)
    rpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtcl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1y62C (C:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
    

    Sequence, based on observed residues (ATOM records):
    >1y62C (C:)
    rpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtcl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1y62D (D:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
    

    Sequence, based on observed residues (ATOM records):
    >1y62D (D:)
    rpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtcl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1y62E (E:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
    

    Sequence, based on observed residues (ATOM records):
    >1y62E (E:)
    rpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtcl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1y62F (F:)
    kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
    

    Sequence, based on observed residues (ATOM records):
    >1y62F (F:)
    rpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtcl