PDB entry 1y60

View 1y60 on RCSB PDB site
Description: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1 with bound 5,10-methylene tetrahydromethanopterin
Class: lyase
Keywords: Pentamer; beta-alpha-beta left handed crossover; TETRAHYDROMETHANOPTERIN-BINDING, LYASE
Deposited on 2004-12-03, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y60a_
  • Chain 'B':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y60b_
  • Chain 'C':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y60c_
  • Chain 'D':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y60d_
  • Chain 'E':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y60e_
  • Heterogens: H4M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y60A (A:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y60A (A:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y60B (B:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y60B (B:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y60C (C:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y60C (C:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y60D (D:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y60E (E:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y60E (E:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan