PDB entry 1y5y

View 1y5y on RCSB PDB site
Description: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1
Class: lyase
Keywords: Pentamer, beta-alpha-beta left handed crossover, flexible C-terminus, LYASE
Deposited on 2004-12-03, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5ya_
  • Chain 'B':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5yb_
  • Chain 'C':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5yc_
  • Chain 'D':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5yd_
  • Chain 'E':
    Compound: Formaldehyde-activating enzyme fae
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: fae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5ye_
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y5yA (A:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5yA (A:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y5yB (B:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5yB (B:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y5yC (C:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5yC (C:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y5yD (D:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5yD (D:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y5yE (E:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5yE (E:)
    akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
    ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
    weaaddakiqkynyeatklsiqravngepkasvvteqr