PDB entry 1y5v

View 1y5v on RCSB PDB site
Description: tRNA-Guanine Transglycosylase (TGT) in complex with 6-Amino-4-(2-phenylethyl)-1,7-dihydro-8H-imidazo[4,5-g]quinazolin-8-one
Class: Transferase
Keywords: Transferase
Deposited on 2004-12-03, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.171
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5va_
  • Heterogens: ZN, NE8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y5vA (A:)
    veataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvra
    tgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseeg
    vtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakr
    srdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemf
    rvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpin
    irnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqki
    rdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5vA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmtkqseegvtfkhmlspersie
    iqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgiq
    qgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmgv
    gkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechcav
    cqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfraryf