PDB entry 1y5o

View 1y5o on RCSB PDB site
Description: NMR structure of the amino-terminal domain from the Tfb1 subunit of yeast TFIIH
Class: transcription
Keywords: TFIIH, Tfb1, PH domain, phosphoinositides, VP16, TRANSCRIPTION
Deposited on 2004-12-02, released 2005-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B 73 kDa subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (0-114)
      • engineered (0)
    Domains in SCOPe 2.06: d1y5oa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y5oA (A:)
    pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
    rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad