PDB entry 1y5h

View 1y5h on RCSB PDB site
Description: Crystal structure of truncated Se-Met Hypoxic Response Protein I (HRPI)
Class: unknown function
Keywords: CBS domain, UNKNOWN FUNCTION
Deposited on 2004-12-02, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.222
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein RV2626C
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2626c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5ha3
  • Chain 'B':
    Compound: hypothetical protein RV2626C
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2626c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y5hb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y5hA (A:)
    gidpftmttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdi
    vikglaagldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgiv
    teadiarhlpeha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5hA (A:)
    ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
    gldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiar
    hlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y5hB (B:)
    gidpftmttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdi
    vikglaagldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgiv
    teadiarhlpeha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5hB (B:)
    ttardimnagvtcvgehetltaaaqymrehdigalpicgdddrlhgmltdrdivikglaa
    gldpntatagelardsiyyvdanasiqemlnvmeehqvrrvpvisehrlvgivteadiar
    hl