PDB entry 1y56

View 1y56 on RCSB PDB site
Description: Crystal structure of L-proline dehydrogenase from P.horikoshii
Deposited on 2004-12-02, released 2005-07-26
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.184
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1363
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: sarcosine oxidase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, CL, SO4, FAD, FMN, ATP, CXS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y56A (A:)
    mlmrpldltekrgkkvtiyfegkeleayegeklpvallaneiywlttsnegrkrgaftfg
    pvpmtvngvkglearrikvkdgmkierqgyydfheepvvepgeiervvvdvaiigggpag
    igaalelqqyltvalieergwlggdmwlkgikqegfnkdsrkvveelvgklnentkiyle
    tsalgvfdkgeyflvpvvrgdklieilakrvvlatgaidstmlfenndmpgvfrrdfale
    vmnvwevapgrkvavtgskadeviqelerwgidyvhipnvkrvegnekvervidmnnhey
    kvdalifadgrrpdinpitqaggklrfrrgyyspvldeyhrikdgiyvagsavsikphya
    nylegklvgayilkefgydaqpciyeeklreyepeslsipripldkfnledvqicgcdvs
    lkkvdevirkgitdlqiikrlthlamgfcqgryclfngavvvsqrtgkklseidlpvars
    piknvkmgilarr
    

    Sequence, based on observed residues (ATOM records):
    >1y56A (A:)
    mrpldltekrgkkvtiyfegkeleayegeklpvallaneiywlttsnegrkrgaftfgpv
    pmtvngvkglearrikvkdgmkierqgyydfheeeiervvvdvaiigggpagigaalelq
    qyltvalieergwlggdmwlkgikqegfnkdsrkvveelvgklnentkiyletsalgvfd
    kgeyflvpvvrgdklieilakrvvlatgaidstmlfenndmpgvfrrdfalevmnvweva
    pgrkvavtgskadeviqelerwgidyvhipnvkrvegnekvervidmnnheykvdalifa
    dgrrpdinpitqaggklrfrrgyyspvldeyhrikdgiyvagsavsikphyanylegklv
    gayilkefgydaqpciyeeklreyepeslsipripldkfnledvqicgcdvslkkvdevi
    rkgitdlqiikrlthlamgfcqgryclfngavvvsqrtgkklseidlpvarspiknvkmg
    ilar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y56B (B:)
    mlpekseivvigggivgvtiahelakrgeevtviekrfigsgstfrcgtgirqqfndean
    vrvmkrsvelwkkyseeygfsfkqtgylfllyddeevktfkrnieiqnkfgvptklitpe
    eakeivplldiseviaaswnptdgkadpfeattafavkakeygaklleytevkgflienn
    eikgvktnkgiiktgivvnatnawanlinamagiktkipiepykhqavitqpikrgtinp
    mvisfkyghayltqtfhggiiggigyeigptydltptyeflrevsyyftkiipalknlli
    lrtwagyyaktpdsnpaigrieelndyyiaagfsghgfmmapavgemvaelitkgktklp
    vewydpyrfergelrtaalqmg
    

    Sequence, based on observed residues (ATOM records):
    >1y56B (B:)
    lpekseivvigggivgvtiahelakrgeevtviekrfigsgstfrcgtgirqqfndeanv
    rvmkrsvelwkkyseeygfsfkqtgylfllyddeevktfkrnieiqnkfgvptklitpee
    akeivplldiseviaaswnptdgkadpfeattafavkakeygaklleytevkgflienne
    ikgvktnkgiiktgivvnatnawanlinamagiktkipiepykhqavitqpikrgtinpm
    visfkyghayltqtfhggiiggigyeigptydltptyeflrevsyyftkiipalknllil
    rtwagyyaktpdsnpaigrieelndyyiaagfsghgfmmapavgemvaelitkgktklpv
    ewydpyrfergelr