PDB entry 1y52

View 1y52 on RCSB PDB site
Description: structure of insect cell (Baculovirus) expressed AVR4 (C122S)-biotin complex
Class: sugar binding protein
Keywords: avidin, avr4, streptavidin, high-affinity, hyper thermostability, SUGAR BINDING PROTEIN
Deposited on 2004-12-02, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (121)
    Domains in SCOPe 2.07: d1y52x1, d1y52x2
  • Chain 'Y':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (121)
    Domains in SCOPe 2.07: d1y52y1, d1y52y2
  • Heterogens: NAG, BTN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1y52X (X:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y52X (X:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1y52Y (Y:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y52Y (Y:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls