PDB entry 1y51

View 1y51 on RCSB PDB site
Description: X-ray crystal structure of Bacillus stearothermophilus Histidine phosphocarrier protein (Hpr) F29W mutant
Class: transport protein
Keywords: Bacillus stearothermophilus Hpr F29W mutant, TRANSPORT PROTEIN
Deposited on 2004-12-01, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.207
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphocarrier protein HPr
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42013 (Start-87)
      • engineered (28)
    Domains in SCOPe 2.07: d1y51a_
  • Chain 'B':
    Compound: Phosphocarrier protein HPr
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42013 (Start-87)
      • engineered (28)
    Domains in SCOPe 2.07: d1y51b_
  • Chain 'C':
    Compound: Phosphocarrier protein HPr
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42013 (Start-87)
      • engineered (28)
    Domains in SCOPe 2.07: d1y51c_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y51A (A:)
    maektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgat
    ikitaegadaaeamaaltdtlakeglae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y51A (A:)
    aektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgati
    kitaegadaaeamaaltdtlakeglae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y51B (B:)
    maektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgat
    ikitaegadaaeamaaltdtlakeglae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y51B (B:)
    aektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgati
    kitaegadaaeamaaltdtlakeglae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y51C (C:)
    maektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgat
    ikitaegadaaeamaaltdtlakeglae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y51C (C:)
    aektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgati
    kitaegadaaeamaaltdtlakeglae