PDB entry 1y50

View 1y50 on RCSB PDB site
Description: X-ray crystal structure of Bacillus stearothermophilus Histidine phosphocarrier protein (Hpr) F29W mutant domain_swapped dimer
Class: transport protein
Keywords: Bacillus stearothermophilus F29W mutant domain-swapped dimer, TRANSPORT PROTEIN
Deposited on 2004-12-01, released 2005-02-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphocarrier protein HPr
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Gene: PTSH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42013 (Start-87)
    • engineered (28)
  Domains in SCOPe 2.05: d1y50a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1y50A (A:)
  maektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgat
  ikitaegadaaeamaaltdtlakeglae
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y50A (A:)
  aektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgati
  kitaegadaaeamaaltdtlakeglae