PDB entry 1y4y

View 1y4y on RCSB PDB site
Description: X-ray crystal structure of Bacillus stearothermophilus Histidine phosphocarrier protein (Hpr)
Class: transport protein
Keywords: Bacillus stearothermophilus Hpr, TRANSPORT PROTEIN
Deposited on 2004-12-01, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphocarrier protein HPr
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y4ya_
  • Chain 'B':
    Compound: Phosphocarrier protein HPr
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y4yb_
  • Chain 'C':
    Compound: Phosphocarrier protein HPr
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PTSH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y4yc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y4yA (A:)
    maektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgat
    ikitaegadaaeamaaltdtlakeglae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4yA (A:)
    aektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgati
    kitaegadaaeamaaltdtlakeglae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y4yB (B:)
    maektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgat
    ikitaegadaaeamaaltdtlakeglae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4yB (B:)
    aektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgati
    kitaegadaaeamaaltdtlakeglae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y4yC (C:)
    maektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgat
    ikitaegadaaeamaaltdtlakeglae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4yC (C:)
    aektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgati
    kitaegadaaeamaaltdtlakeglae