PDB entry 1y4u

View 1y4u on RCSB PDB site
Description: Conformation rearrangement of heat shock protein 90 upon ADP binding
Deposited on 2004-12-01, released 2005-04-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein htpG
    Species: Escherichia coli [TaxId:562]
    Gene: htpG
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Chaperone protein htpG
    Species: Escherichia coli [TaxId:562]
    Gene: htpG
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y4uA (A:)
    mkgqetrgfqsevkqllhlmihslysnkeiflrelisnasdaadklrfralsnpdlyegd
    gelrvrvsfdkdkrtltisdngvgmtrdevidhlgtiaksgtksfleslgsdqakdsqli
    gqfgvgfysafivadkvtvrtraagekpengvfwesagegeytvaditkedrgteitlhl
    regedeflddwrvrsiiskysdhialpveiekreekdgetviswekinkaqalwtrnkse
    itdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmwnrdhkhglkly
    vqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlrnaltkrvlqml
    eklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtdssaqtvsledyv
    srmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmmnyltefdgkpf
    qsvskvdeslekladevdesakeaekaltpfidrvkallgervkdvrlthrltdtpaivs
    tdademstqmaklfaaagq
    

    Sequence, based on observed residues (ATOM records):
    >1y4uA (A:)
    mkgqetrgfqsevkqllhlmihslysnkeiflrelisnasdaadklrfralsnpdlyegd
    gelrvrvsfdkdkrtltisdngvgmtrdevidhlgtiaksgtigqfgvgfysafivadkv
    tvrtraagekpengvfwesagegeytvaditkedrgteitlhlregedeflddwrvrsii
    skysdhialpveiekreekdgetviswekinkaqalwtrnkseitdeeykefykhiahdf
    ndpltwshnrvegkqeytsllyipsqapwdmwnrdhkhglklyvqrvfimddaeqfmpny
    lrfvrglidssdlplnvsreilqdstvtrnlrnaltkrvlqmleklakddaekyqtfwqq
    fglvlkegpaedfanqeaiakllrfasthtdssaqtvsledyvsrmkegqekiyyitads
    yaaakssphlellrkkgievlllsdridewmmnyltefdgkpfqsvskvdes
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y4uB (B:)
    mkgqetrgfqsevkqllhlmihslysnkeiflrelisnasdaadklrfralsnpdlyegd
    gelrvrvsfdkdkrtltisdngvgmtrdevidhlgtiaksgtksfleslgsdqakdsqli
    gqfgvgfysafivadkvtvrtraagekpengvfwesagegeytvaditkedrgteitlhl
    regedeflddwrvrsiiskysdhialpveiekreekdgetviswekinkaqalwtrnkse
    itdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmwnrdhkhglkly
    vqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlrnaltkrvlqml
    eklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtdssaqtvsledyv
    srmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmmnyltefdgkpf
    qsvskvdeslekladevdesakeaekaltpfidrvkallgervkdvrlthrltdtpaivs
    tdademstqmaklfaaagq
    

    Sequence, based on observed residues (ATOM records):
    >1y4uB (B:)
    qllhlmihslysnkeiflrelisnasdaadklrfralsnpdlyegdgelrvrvsfdkdkr
    tltisdngvgmtrdevidhlgtiaigqfgvgfysafivadkvtvrtraagekpengvfwe
    sagegeytvaditkedrgteitlhlregedeflddwrvrsiiskysdhialpveiekree
    kdgetviswekinkaqalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeyt
    sllyipsqapwdmwnrdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvs
    reilqdstvtrnlrnaltkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqea
    iakllrfasthtdssaqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgi
    evlllsdridewmmnyltefdgkpfqsvskvdes