PDB entry 1y4t

View 1y4t on RCSB PDB site
Description: Ferric binding protein from Campylobacter jejuni
Class: metal binding protein
Keywords: iron-tyrosinate, periplasmic binding protein, METAL BINDING PROTEIN
Deposited on 2004-12-01, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative iron-uptake ABC transport system periplasmic iron-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y4ta_
  • Chain 'D':
    Compound: putative iron-uptake ABC transport system periplasmic iron-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y4td_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y4tA (A:)
    aselniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitad
    isnlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmk
    nyedlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdr
    dqarqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiam
    tkssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvsk
    iaenikeavkiydevgfriegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4tA (A:)
    selniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitadi
    snlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmkn
    yedlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdrd
    qarqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiamt
    kssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvski
    aenikeavkiydevgfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y4tD (D:)
    aselniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitad
    isnlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmk
    nyedlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdr
    dqarqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiam
    tkssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvsk
    iaenikeavkiydevgfriegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4tD (D:)
    elniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitadis
    nlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmkny
    edlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdrdq
    arqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiamtk
    ssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvskia
    enikeavkiydevgfr