PDB entry 1y4o
View 1y4o on RCSB PDB site
Description: Solution structure of a mouse cytoplasmic Roadblock/LC7 dynein light chain
Class: contractile protein
Keywords: Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, Dynein Light Chain, CONTRACTILE PROTEIN
Deposited on
2004-12-01, released
2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dynein light chain 2A, cytoplasmic
Species: Mus musculus [TaxId:10090]
Gene: Dncl2a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1y4oa1, d1y4oa2 - Chain 'B':
Compound: Dynein light chain 2A, cytoplasmic
Species: Mus musculus [TaxId:10090]
Gene: Dncl2a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1y4ob2, d1y4ob3
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1y4oA (A:)
ghhhhhhleaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilk
arstvreidpqndltflrirskkneimvapdkdyfliviqnpte
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1y4oB (B:)
ghhhhhhleaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilk
arstvreidpqndltflrirskkneimvapdkdyfliviqnpte