PDB entry 1y4m

View 1y4m on RCSB PDB site
Description: Crystal structure of human endogenous retrovirus HERV-FRD envelope protein (syncitin-2)
Class: membrane protein
Keywords: Coat protein, membrane fusion, endogenous retrovirus, MEMBRANE PROTEIN
Deposited on 2004-12-01, released 2005-11-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.248
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HERV-FRD_6p24.1 provirus ancestral Env polyprotein
  Species: Homo sapiens [TaxId:9606]
  Gene: ERVFRDE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60508 (0-52)
  Domains in SCOPe 2.05: d1y4ma1
• Chain 'B':
  Compound: HERV-FRD_6p24.1 provirus ancestral Env polyprotein
  Species: Homo sapiens [TaxId:9606]
  Gene: ERVFRDE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60508 (0-52)
  Domains in SCOPe 2.05: d1y4mb_
• Chain 'C':
  Compound: HERV-FRD_6p24.1 provirus ancestral Env polyprotein
  Species: Homo sapiens [TaxId:9606]
  Gene: ERVFRDE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60508 (0-52)
  Domains in SCOPe 2.05: d1y4mc_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y4mA (A:)
  nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y4mB (B:)
  nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y4mC (C:)
  nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn