PDB entry 1y4m

View 1y4m on RCSB PDB site
Description: Crystal structure of human endogenous retrovirus HERV-FRD envelope protein (syncitin-2)
Class: membrane protein
Keywords: Coat protein, membrane fusion, endogenous retrovirus, MEMBRANE PROTEIN
Deposited on 2004-12-01, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.248
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HERV-FRD_6p24.1 provirus ancestral Env polyprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: ERVFRDE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y4ma1
  • Chain 'B':
    Compound: HERV-FRD_6p24.1 provirus ancestral Env polyprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: ERVFRDE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y4mb_
  • Chain 'C':
    Compound: HERV-FRD_6p24.1 provirus ancestral Env polyprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: ERVFRDE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y4mc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y4mA (A:)
    nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y4mB (B:)
    nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y4mC (C:)
    nidtmakalttmqeqidslaavvlqnrrgldmltaaqggiclaldekccfwvn