PDB entry 1y4k

View 1y4k on RCSB PDB site
Description: Lipoxygenase-1 (Soybean) at 100K, N694G Mutant
Class: oxidoreductase
Keywords: Lipoxygenase, dioxygenase, metalloprotein, fatty acids, iron, OXIDOREDUCTASE
Deposited on 2004-12-01, released 2005-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • engineered (693)
    Domains in SCOPe 2.06: d1y4ka1, d1y4ka2
  • Heterogens: FE2, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y4kA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplvsyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavgfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4kA (A:)
    hkikgtvvlmpknnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
    esafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntklyksvr
    iffanhtyvpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdksekl
    arpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtks
    lsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdg
    qhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqss
    kitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredg
    tlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwl
    nthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpsk
    ysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaai
    ktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcli
    iiwiasalhaavgfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsk
    lptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnn
    dpslqgnrlgpvqlpytllypsseegltfrgipnsisi