PDB entry 1y4j

View 1y4j on RCSB PDB site
Description: Crystal structure of the paralogue of the human formylglycine generating enzyme
Class: sugar binding protein
Keywords: formylglycine, sulfatases, multiple sulfatase deficiency, homodimer, duf323, SUGAR BINDING PROTEIN
Deposited on 2004-12-01, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfatase modifying factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y4ja1
  • Chain 'B':
    Compound: Sulfatase modifying factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y4jb_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y4jA (A:)
    atsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrte
    aemfgwsfvfedfvsdelrnkatqpmksvlwwlpvekafwrqpagpgsgirerlehpvlh
    vswndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdka
    edgfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsan
    hrarvttrmgntpdsasdnlgfrcaadagrppgelrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4jA (A:)
    tsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrtea
    emfgwsfvfedfvsdelrnkaqpmksvlwwlpvekafwrqpagpgsgirerlehpvlhvs
    wndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdkaed
    gfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsanhr
    arvttrmgntpdsasdnlgfrcaada
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y4jB (B:)
    atsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrte
    aemfgwsfvfedfvsdelrnkatqpmksvlwwlpvekafwrqpagpgsgirerlehpvlh
    vswndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdka
    edgfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsan
    hrarvttrmgntpdsasdnlgfrcaadagrppgelrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4jB (B:)
    atsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrte
    aemfgwsfvfedfvsdelrnkatqpmksvlwwlpvekafwrqpagpgsgirerlehpvlh
    vswndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdka
    edgfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsan
    hrarvttrmgntpdsasdnlgfrcaada