PDB entry 1y4i

View 1y4i on RCSB PDB site
Description: Crystal structure of Citrobacter Freundii L-methionine-lyase
Class: lyase
Keywords: pyridoxal-5'-phosphate, PLP-dependent enzyme, LYASE
Deposited on 2004-12-01, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: megL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84AR1 (Start-397)
      • see remark 999 (132)
      • modified residue (209)
    Domains in SCOPe 2.08: d1y4ia1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y4iA (A:)
    msdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytr
    lgnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafl
    shsmpkfginvrfvdagkpeeiraamrpetkvvyietpanptlslvdietvagiahqqga
    llvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkd
    itggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqye
    lgqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvap
    eerlkagitdglirlsvgledpediindlehairkatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4iA (A:)
    sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
    gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
    hsmpkfginvrfvdagkpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
    lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
    tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
    gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
    erlkagitdglirlsvgledpediindlehairkatf