PDB entry 1y4c

View 1y4c on RCSB PDB site
Description: Designed Helical Protein fusion MBP
Class: de novo protein
Keywords: De Novo Designed Helical Protein, Maltose binding protein fusion, DE NOVO PROTEIN
Deposited on 2004-11-30, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose binding protein fused with designed helical protein
    Species: Escherichia coli [TaxId:562]
    Gene: malE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y4ca1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y4cA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtnsssnnnnnnnnnnlgiegrsseellkialqeaqktlqqaqelakkgggeeqlk
    ralkradrnlwaaqelakkggggeellkqalqqaqqllrqaqelakkgggeellkqalqq
    aqqllqqaqelakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y4cA (A:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtnssslgiegrsseellkialqeaqktlqqaqelakkgggeeqlkralkradrnlwaa
    qelakkggggeellkqalqqaqqllrqaqelakkgggeellkqalqqaqqllqqaqelak