PDB entry 1y47

View 1y47 on RCSB PDB site
Description: Structural studies of designed alpha-helical hairpins
Class: de novo protein
Keywords: Protein design, helical hairpin, turns, diiron proteins, DE NOVO PROTEIN
Deposited on 2004-11-30, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dueferri (DF2)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y47 (0-45)
    Domains in SCOPe 2.07: d1y47a1
  • Chain 'B':
    Compound: dueferri (DF2)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y47 (0-45)
    Domains in SCOPe 2.07: d1y47b1
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y47A (A:)
    dylrelykleqqamklyreaservgdpvlakiledeekhiewleti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y47B (B:)
    dylrelykleqqamklyreaservgdpvlakiledeekhiewleti