PDB entry 1y44

View 1y44 on RCSB PDB site
Description: Crystal structure of RNase Z
Class: hydrolase
Keywords: zinc-dependent metal hydrolase, hydrolase
Deposited on 2004-11-30, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease z
    Species: Bacillus subtilis [TaxId:1423]
    Gene: RNZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54548 (0-306)
      • modified residue (0)
      • engineered (45)
      • modified residue (63)
      • engineered (227)
    Domains in SCOPe 2.07: d1y44a1
  • Chain 'B':
    Compound: ribonuclease z
    Species: Bacillus subtilis [TaxId:1423]
    Gene: RNZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54548 (0-306)
      • modified residue (0)
      • engineered (45)
      • modified residue (63)
      • modified residue (165)
      • engineered (227)
    Domains in SCOPe 2.07: d1y44b_
  • Heterogens: ZN, PO4, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y44A (A:)
    mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
    ithmhgdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
    eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
    etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk
    laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl
    evnvprgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y44A (A:)
    mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
    ithmhgdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
    eegivfeddqfivtavsvihgveafgyrvqekdvpgslleppkkgrsvvfsgdtrvsdkl
    kelardcdvmvheatfakedrklaydyyhstteqaavtakearakqlilthisaryqgda
    slelqkeavdvfpnsvaaydflevnvprg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y44B (B:)
    mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
    ithmhgdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
    eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
    etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk
    laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl
    evnvprgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y44B (B:)
    mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
    ithmhgdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
    eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
    etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakhstt
    eqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydflevnvprg