SCOPe 2.08: Structural Classification of Proteins

PDB entry 1y43

View 1y43 on RCSB PDB site
Description: crystal structure of aspergilloglutamic peptidase from Aspergillus niger
Class: hydrolase
Keywords: aspergillopepsin II, proctase A, beta sandwich structure, HYDROLASE
Deposited on 2004-11-30, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Aspergillopepsin II light chain
Species: Aspergillus niger var. macrosporus [TaxId:29838]
Database cross-references and differences (RAF-indexed):
- Uniprot P24665 (0-End)
Domains in SCOPe 2.08: d1y43.1
Chain 'B':
Compound: Aspergillopepsin II heavy chain
Species: Aspergillus niger var. macrosporus [TaxId:29838]
Database cross-references and differences (RAF-indexed):
- Uniprot P24665 (Start-172)
Domains in SCOPe 2.08: d1y43.1
Heterogens: SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)
```
>1y43A (A:)
eeyssnwagavligdgytkvtgeftvpsvsagssgssgy
```
Sequence, based on observed residues (ATOM records): (download)
```
>1y43A (A:)
eeyssnwagavligdgytkvtgeftvpsvsag
```

Chain 'B':
Sequence, based on SEQRES records: (download)

>1y43B (B:)
qseeycasawvgidgdtcetailqtgvdfcyedgqtsydawyewypdyaydfsditiseg
dsikvtveatskssgsatvenlttgqsvthtfsgnvegdlcetnaewivedfesgdslva
fadfgsvtftnaeatsggstvgpsdatvmdieqdgsvltetsvsgdsvtvtyv

Sequence, based on observed residues (ATOM records): (download)

>1y43B (B:)
eeycasawvgidgdtcetailqtgvdfcyedgqtsydawyewypdyaydfsditisegds
ikvtveatskssgsatvenlttgqsvthtfsgnvegdlcetnaewivedfesgdslvafa
dfgsvtftnaeatsggstvgpsdatvmdieqdgsvltetsvsgdsvtvtyv