PDB entry 1y43

View 1y43 on RCSB PDB site
Description: crystal structure of aspergilloglutamic peptidase from Aspergillus niger
Class: hydrolase
Keywords: aspergillopepsin II, proctase A, beta sandwich structure, HYDROLASE
Deposited on 2004-11-30, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspergillopepsin II light chain
    Species: Aspergillus niger var. macrosporus [TaxId:29838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y43.1
  • Chain 'B':
    Compound: Aspergillopepsin II heavy chain
    Species: Aspergillus niger var. macrosporus [TaxId:29838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y43.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y43A (A:)
    eeyssnwagavligdgytkvtgeftvpsvsagssgssgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y43A (A:)
    eeyssnwagavligdgytkvtgeftvpsvsag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y43B (B:)
    qseeycasawvgidgdtcetailqtgvdfcyedgqtsydawyewypdyaydfsditiseg
    dsikvtveatskssgsatvenlttgqsvthtfsgnvegdlcetnaewivedfesgdslva
    fadfgsvtftnaeatsggstvgpsdatvmdieqdgsvltetsvsgdsvtvtyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y43B (B:)
    eeycasawvgidgdtcetailqtgvdfcyedgqtsydawyewypdyaydfsditisegds
    ikvtveatskssgsatvenlttgqsvthtfsgnvegdlcetnaewivedfesgdslvafa
    dfgsvtftnaeatsggstvgpsdatvmdieqdgsvltetsvsgdsvtvtyv