PDB entry 1y42

View 1y42 on RCSB PDB site
Description: crystal structure of a c-terminally truncated cyt-18 protein
Deposited on 2004-11-29, released 2005-02-15
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: tyrosyl-tRNA synthetase, mitochondrial
    Species: Neurospora crassa [TaxId:5141]
    Gene: cyt-18
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TYR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1y42X (X:)
    mlrrefgpkytakineaeenwqaraeaikkgkkqntwdlfeergyvkdtagtkehiaelm
    rtrrigayvgidptapslhvghllplmplfwmylegykaftliggstakigdptgrlksr
    dhlsssdatmnmtkihyqlkklwenvdtqmrargyeadwarkrgivnnnhwwnkqpmlev
    lrrvghalrigpmlsrdtvknkmtqgdgvsfaeftypimqgwdwfelfyqqgvqmqiggs
    dqygniisglevvkaaresepdpqerkyvtpktaldecvgftvplltdssgakfgksagn
    aiwldpyqtsvfdfygyfvrrsdqevenllklftfmpiseitktmeehikdpskrvaqht
    larevvtlvhgkqeasaaedqhrmmytgqmti
    

    Sequence, based on observed residues (ATOM records):
    >1y42X (X:)
    pkytakineaeenwqaraeaikkgkkqntwdlfeergyvkdtagtkehiaelmrtrriga
    yvgidptapslhvghllplmplfwmylegykaftliggstakigdptgdatmnmtkihyq
    lkklwenvdtqmrargyeadwarkrgivnnnhwwnkqpmlevlrrvghalrigpmlsrdt
    vknkmtqgdgvsfaeftypimqgwdwfelfyqqgvqmqiggsdqygniisglevvkaare
    sepdpqerkyvtpktaldecvgftvplltdssgakfgksagnaiwldpyqtsvfdfygyf
    vrrsdqevenllklftfmpiseitktmeehikdpskrvaqhtlarevvtlvhgkqeasaa
    edqhrmmytg