PDB entry 1y41

View 1y41 on RCSB PDB site
Description: Solution structure of human translationally controlled tumor protein
Class: unknown function
Keywords: tumor protein
Deposited on 2004-11-29, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translationally controlled tumor protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13693 (0-171)
      • his tag (172-179)
    Domains in SCOPe 2.07: d1y41a1, d1y41a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y41A (A:)
    miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
    gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
    qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekclehhhhhh