PDB entry 1y3t

View 1y3t on RCSB PDB site
Description: Crystal structure of YxaG, a dioxygenase from Bacillus subtilis
Class: Oxidoreductase
Keywords: Bi cupin, dioxygenase, Oxidoreductase
Deposited on 2004-11-26, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yxaG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y3ta1
  • Chain 'B':
    Compound: Hypothetical protein yxaG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y3tb_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y3tA (A:)
    mktlcthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafp
    lhvhkdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmk
    gnvahlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaelte
    lpdgavpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyht
    etfyclegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffr
    tlgdpyeghifpckpqalrfdrilqniealdlkvmkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3tA (A:)
    cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh
    kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva
    hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg
    avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy
    clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd
    pyeghifpckpqalrfdrilqniealdlkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y3tB (B:)
    mktlcthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafp
    lhvhkdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmk
    gnvahlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaelte
    lpdgavpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyht
    etfyclegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffr
    tlgdpyeghifpckpqalrfdrilqniealdlkvmkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3tB (B:)
    cthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplhvh
    kdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgnva
    hlysvignpydhaehppyaseevsnerfaeaaavativfldeakpacsaklaeltelpdg
    avpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtetfy
    clegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtlgd
    pyeghifpckpqalrfdrilqniealdlkv