PDB entry 1y3n

View 1y3n on RCSB PDB site
Description: Structure of AlgQ1, alginate-binding protein, complexed with an alginate disaccharide
Class: sugar binding protein
Keywords: SUGAR BINDING PROTEIN, alginate
Deposited on 2004-11-26, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AlgQ1
    Species: Sphingomonas sp. [TaxId:90322]
    Database cross-references and differences (RAF-indexed):
    • GB BAB03317 (0-489)
    Domains in SCOPe 2.07: d1y3na1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y3nA (A:)
    reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl
    mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap
    dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade
    ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke
    glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk
    gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk
    pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq
    ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi
    vmqkaydrqy