PDB entry 1y3j

View 1y3j on RCSB PDB site
Description: Solution structure of the copper(I) form of the fifth domain of Menkes protein
Class: hydrolase
Keywords: ferrodoxin-like fold, beta-alpha-beta-beta-alpha-beta structure, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE
Deposited on 2004-11-25, released 2005-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Copper-transporting ATPase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ATP7A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04656 (0-72)
    • cloning artifact (73-76)
  Domains in SCOPe 2.05: d1y3ja_
• Heterogens: CU

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y3jA (A:)
  nsskcyiqvtgmtcascvaniernlrreegiysilvalmagkaevrynpaviqppmiaef
  irelgfgatvieniegr