PDB entry 1y3i

View 1y3i on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis NAD kinase-NAD complex
Class: transferase
Keywords: NAD kinase, polyphosphate, NAD, Mycobacterium tuberculosis, TRANSFERASE
Deposited on 2004-11-25, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y3ia_
  • Chain 'B':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y3ib_
  • Heterogens: SO4, NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y3iA (A:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vtgwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3iA (A:)
    vllvvhlvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidavlehvvaq
    dyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgv
    lvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeatiaieieadghd
    alvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlpvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y3iB (B:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vtgwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3iB (B:)
    vllvvhlvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidavlehvvaq
    dyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgv
    lvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeatiaieieadghd
    alvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlpvt