PDB entry 1y3h

View 1y3h on RCSB PDB site
Description: Crystal Structure of Inorganic Polyphosphate/ATP-NAD kinase from Mycobacterium tuberculosis
Class: transferase
Keywords: NAD kinase, polyphosphate, NAD, ATP, TRANSFERASE
Deposited on 2004-11-24, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5S6 (Start-306)
      • engineered (301)
    Domains in SCOPe 2.07: d1y3ha_
  • Chain 'B':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5S6 (Start-306)
      • engineered (301)
    Domains in SCOPe 2.07: d1y3hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y3hA (A:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vigwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3hA (A:)
    rsvllvvhttetarrvekvlgdnkialrvlshaadgcelvlvlggdgtflraaelarnas
    ipvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedrltldvvvrqggrivnrgwaln
    evslekgprlgvlgvvveidgrpvsafgcdgvlvstptgstayafsaggpvlwpdleail
    vvpnnahalfgrpmvtspeatiaieieadghdalvfcdgrremlipagsrlevtrcvtsv
    kwarldsapftdrlvrkfrlpvigwrgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y3hB (B:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vigwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3hB (B:)
    rsvllvvhtetarrvekvlgdnkialrvlshaadgcelvlvlggdgtflraaelarnasi
    pvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedrltldvvvrqggrivnrgwalne
    vslekgprlgvlgvvveidgrpvsafgcdgvlvstptgstayafsaggpvlwpdleailv
    vpnnahalfgrpmvtspeatiaieieadghdalvfcdgrremlipagsrlevtrcvtsvk
    warldsapftdrlvrkfrlpvigwrgk