PDB entry 1y39

View 1y39 on RCSB PDB site
Description: Co-evolution of protein and RNA structures within a highly conserved ribosomal domain
Class: structural protein/RNA
Keywords: X-Ray Crystal structure, Choroplast-Like L11 complex, rRNA, 23S RNA, STRUCTURAL PROTEIN-RNA COMPLEX
Deposited on 2004-11-24, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56210
      • engineered (68)
    Domains in SCOPe 2.07: d1y39a1
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56210 (Start-75)
      • engineered (68)
    Domains in SCOPe 2.07: d1y39b1
  • Chain 'C':
    Compound: 58 nucleotide ribosomal 23s RNA domain
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 58 nucleotide ribosomal 23s RNA domain
    Species: synthetic, synthetic
  • Heterogens: 3CO, K, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1y39A (A:)
ftfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarnmgivved

    Sequence, based on observed residues (ATOM records): (download) 
    >1y39A (A:)
tfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamr
miegtarnmgivve

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1y39B (B:)
ftfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarnmgivved

    Sequence, based on observed residues (ATOM records): (download) 
    >1y39B (B:)
tktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamrmie
gtarnmgivved

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.