PDB entry 1y37

View 1y37 on RCSB PDB site
Description: Structure of Fluoroacetate Dehalogenase from Burkholderia sp. FA1
Class: hydrolase
Keywords: dehalogenase, HYDROLASE
Deposited on 2004-11-23, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Burkholderia sp. [TaxId:384033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y37a_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Burkholderia sp. [TaxId:384033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y37b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y37A (A:)
    mfegferrlvdvgdvtincvvggsgpallllhgfpqnlhmwarvapllaneytvvcadlr
    gyggsskpvgapdhanysframasdqrelmrtlgferfhlvghdrggrtghrmaldhpds
    vlslavldiiptyvmfeevdrfvaraywhwyflqqpapypekvigadpdtfyegclfgwg
    atgadgfdpeqleeyrkqwrdpaaihgsccdyraggtidfeldhgdlgrqvqcpalvfsg
    saglmhslfemqvvwaprlanmrfaslpgghffvdrfpddtarilreflsdarsgihqte
    rres
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y37A (A:)
    mfegferrlvdvgdvtincvvggsgpallllhgfpqnlhmwarvapllaneytvvcadlr
    gyggsskpvgapdhanysframasdqrelmrtlgferfhlvghdrggrtghrmaldhpds
    vlslavldiiptyvmfeevdrfvaraywhwyflqqpapypekvigadpdtfyegclfgwg
    atgadgfdpeqleeyrkqwrdpaaihgsccdyraggtidfeldhgdlgrqvqcpalvfsg
    saglmhslfemqvvwaprlanmrfaslpgghffvdrfpddtarilreflsdars
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y37B (B:)
    mfegferrlvdvgdvtincvvggsgpallllhgfpqnlhmwarvapllaneytvvcadlr
    gyggsskpvgapdhanysframasdqrelmrtlgferfhlvghdrggrtghrmaldhpds
    vlslavldiiptyvmfeevdrfvaraywhwyflqqpapypekvigadpdtfyegclfgwg
    atgadgfdpeqleeyrkqwrdpaaihgsccdyraggtidfeldhgdlgrqvqcpalvfsg
    saglmhslfemqvvwaprlanmrfaslpgghffvdrfpddtarilreflsdarsgihqte
    rres
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y37B (B:)
    mfegferrlvdvgdvtincvvggsgpallllhgfpqnlhmwarvapllaneytvvcadlr
    gyggsskpvgapdhanysframasdqrelmrtlgferfhlvghdrggrtghrmaldhpds
    vlslavldiiptyvmfeevdrfvaraywhwyflqqpapypekvigadpdtfyegclfgwg
    atgadgfdpeqleeyrkqwrdpaaihgsccdyraggtidfeldhgdlgrqvqcpalvfsg
    saglmhslfemqvvwaprlanmrfaslpgghffvdrfpddtarilreflsdars