PDB entry 1y2y

View 1y2y on RCSB PDB site
Description: Structural Characterization of Nop10p using Nuclear Magnetic Resonance Spectroscopy
Class: biosynthetic protein
Keywords: Box H/ACA snoRNA,snoRNP, pseudouridine, BIOSYNTHETIC PROTEIN
Deposited on 2004-11-23, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome biogenesis protein Nop10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NOP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y2ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2yA (A:)
    mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtlkkrfglvpgq