PDB entry 1y2x

View 1y2x on RCSB PDB site
Description: crystal structure of the tetragonal form of the common edible mushroom (agaricus bisporus) lectin in complex with t-antigen and n- acetylglucosamine
Deposited on 2004-11-23, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y2xa_
  • Chain 'B':
    Domains in SCOP 1.71: d1y2xb_
  • Chain 'C':
    Domains in SCOP 1.71: d1y2xc_
  • Chain 'D':
    Domains in SCOP 1.71: d1y2xd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xA (A:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xB (B:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xC (C:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xD (D:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig