PDB entry 1y2v

View 1y2v on RCSB PDB site
Description: Crystal structure of the common edible mushroom (Agaricus bisporus) lectin in complex with T-antigen
Class: sugar binding protein
Keywords: ABL, Agaricus bisporus, lectin, mushroom, T-antigen
Deposited on 2004-11-23, released 2004-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: AGARICUS BISPORUS
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOP 1.73: d1y2va_
  • Chain 'B':
    Compound: lectin
    Species: AGARICUS BISPORUS
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOP 1.73: d1y2vb_
  • Heterogens: SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2vA (A:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2vB (B:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig