PDB entry 1y2v

View 1y2v on RCSB PDB site
Description: crystal structure of the common edible mushroom (agaricus bisporus) lectin in complex with t-antigen
Deposited on 2004-11-23, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y2va_
  • Chain 'B':
    Domains in SCOP 1.71: d1y2vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2vA (A:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2vB (B:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig