PDB entry 1y2u

View 1y2u on RCSB PDB site
Description: Crystal structure of the common edible mushroom (Agaricus bisporus) lectin in complex with Lacto-N-biose
Class: sugar binding protein
Keywords: ABL, Agaricus bisporus, lectin, mushroom, lacto-N-biose, SUGAR BINDING PROTEIN
Deposited on 2004-11-23, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Agaricus bisporus [TaxId:5341]
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOPe 2.08: d1y2ua_
  • Chain 'B':
    Compound: lectin
    Species: Agaricus bisporus [TaxId:5341]
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOPe 2.08: d1y2ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y2uA (A:)
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y2uB (B:)
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig