PDB entry 1y2s

View 1y2s on RCSB PDB site
Description: ovine prion protein variant r168
Deposited on 2004-11-23, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y2sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y2sA (A:)
gsvvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhd
cvnitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas