PDB entry 1y2i

View 1y2i on RCSB PDB site
Description: Crystal Structure of MCSG Target APC27401 from Shigella flexneri
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, Pentamer, Hypothetical Protein, Protein Structure Initiative, PSI, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-11-22, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical Protein S0862
    Species: Shigella flexneri [TaxId:198215]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83LS2 (24-130)
      • modified residue (24)
      • modified residue (116)
      • modified residue (118)
      • cloning artifact (131-132)
    Domains in SCOPe 2.07: d1y2ia1, d1y2ia2
  • Chain 'B':
    Compound: Hypothetical Protein S0862
    Species: Shigella flexneri [TaxId:198215]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83LS2 (24-130)
      • modified residue (24)
      • modified residue (116)
      • modified residue (118)
      • cloning artifact (131-132)
    Domains in SCOPe 2.07: d1y2ib1, d1y2ib2
  • Chain 'C':
    Compound: Hypothetical Protein S0862
    Species: Shigella flexneri [TaxId:198215]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83LS2 (24-130)
      • modified residue (24)
      • modified residue (116)
      • modified residue (118)
      • cloning artifact (131-132)
    Domains in SCOPe 2.07: d1y2ic1, d1y2ic2
  • Chain 'D':
    Compound: Hypothetical Protein S0862
    Species: Shigella flexneri [TaxId:198215]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83LS2 (24-130)
      • modified residue (24)
      • modified residue (116)
      • modified residue (118)
      • cloning artifact (131-132)
    Domains in SCOPe 2.07: d1y2id1, d1y2id2
  • Chain 'E':
    Compound: Hypothetical Protein S0862
    Species: Shigella flexneri [TaxId:198215]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83LS2 (24-130)
      • modified residue (24)
      • modified residue (116)
      • modified residue (118)
      • cloning artifact (131-132)
    Domains in SCOPe 2.07: d1y2ie1, d1y2ie2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y2iA (A:)
    mhhhhhhssgvdlgtenlyfqsnamqfsttptlegltiveycgvvtgeailganifrdff
    agirdivggrsgayekelrkareiafeelgsqaralgadavvgididyetvgqngsmlmv
    svsgtavktrrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2iA (A:)
    mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
    afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y2iB (B:)
    mhhhhhhssgvdlgtenlyfqsnamqfsttptlegltiveycgvvtgeailganifrdff
    agirdivggrsgayekelrkareiafeelgsqaralgadavvgididyetvgqngsmlmv
    svsgtavktrrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2iB (B:)
    mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
    afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y2iC (C:)
    mhhhhhhssgvdlgtenlyfqsnamqfsttptlegltiveycgvvtgeailganifrdff
    agirdivggrsgayekelrkareiafeelgsqaralgadavvgididyetvgqngsmlmv
    svsgtavktrrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2iC (C:)
    mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
    afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y2iD (D:)
    mhhhhhhssgvdlgtenlyfqsnamqfsttptlegltiveycgvvtgeailganifrdff
    agirdivggrsgayekelrkareiafeelgsqaralgadavvgididyetvgqngsmlmv
    svsgtavktrrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2iD (D:)
    mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
    afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y2iE (E:)
    mhhhhhhssgvdlgtenlyfqsnamqfsttptlegltiveycgvvtgeailganifrdff
    agirdivggrsgayekelrkareiafeelgsqaralgadavvgididyetvgqngsmlmv
    svsgtavktrrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2iE (E:)
    mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
    afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni