PDB entry 1y2g

View 1y2g on RCSB PDB site
Description: Crystal STructure of ZipA in complex with an inhibitor
Class: cell cycle
Keywords: cell cycle
Deposited on 2004-11-22, released 2005-03-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene: zipa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y2ga_
  • Chain 'B':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene: zipa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y2gb_
  • Heterogens: CL3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y2gA (A:)
    krkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanm
    vkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmm
    tpqklreyqdiirevkdana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2gA (A:)
    rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
    kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
    pqklreyqdiirevkda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2gB (B:)
    krkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanm
    vkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmm
    tpqklreyqdiirevkdana