PDB entry 1y2f

View 1y2f on RCSB PDB site
Description: Crystal Structure of ZipA with an inhibitor
Class: cell cycle
Keywords: cell cycle
Deposited on 2004-11-22, released 2005-03-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1y2fa_
  • Heterogens: WAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y2fA (A:)
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana