PDB entry 1y2c

View 1y2c on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With 3,5-dimethyl-1-phenyl-1H-pyrazole-4-carboxylic acid ethyl ester
Class: Hydrolase
Keywords: Phosphodiesterase, PDE, PDE4D, Pyrazole, Hydrolase
Deposited on 2004-11-22, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y2ca_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y2cb_
  • Heterogens: ZN, MG, 3DE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y2cA (A:)
    mgsshhhhhhssglvprgshmteqedvlakeledvnkwglhvfriaelsgnrpltvimht
    ifqerdllktfkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleav
    ftdleilaaifasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqee
    ncdifqnltkkqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnys
    driqvlqnmvhcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnas
    veksqvgfidyivhplwetwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2cA (A:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y2cB (B:)
    mgsshhhhhhssglvprgshmteqedvlakeledvnkwglhvfriaelsgnrpltvimht
    ifqerdllktfkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleav
    ftdleilaaifasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqee
    ncdifqnltkkqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnys
    driqvlqnmvhcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnas
    veksqvgfidyivhplwetwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2cB (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstip