PDB entry 1y2a

View 1y2a on RCSB PDB site
Description: Structure of mammalian importin bound to the non-classical PLSCR1-NLS
Class: Protein transport
Keywords: Armadillo repeat; protein:peptide complex; superhelix of helices, Protein transport
Deposited on 2004-11-22, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: importin alpha-2 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y2ac_
  • Chain 'P':
    Compound: decamer fragment of Phospholipid scramblase 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y2aC (C:)
    nqgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflg
    ktdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni
    agdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldav
    eqilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpi
    vtpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdq
    iqqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnll
    sakdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasl
    nliekyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y2aC (C:)
    nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
    piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
    afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
    tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
    raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
    nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
    kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
    yfs
    

  • Chain 'P':
    No sequence available.