PDB entry 1y28

View 1y28 on RCSB PDB site
Description: Crystal structure of the R220A metBJFIXL HEME domain
Class: transferase
Keywords: pas fold, oxygen sensing
Deposited on 2004-11-21, released 2004-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.251
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: Bradyrhizobium japonicum
    Gene: fixL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23222 (12-130)
      • engineered (80)
    Domains in SCOP 1.73: d1y28a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y28A (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigaivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y28A (A:)
    ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
    dphiigigaivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq